The isoforms and variants of the protein under investigation can be identified from the following websites: Identify the existence of variants/isoforms IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFERĭQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKGįigure legend Uniprot PIM2 canonical sequence showing the aminoacid sequence.
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL Result from the Uniprot search: MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI Use the Uniprot website to identify PIM2 protein sequence.Ī video demonstrating how the PIM2 canonical sequence can be obtained from the Uniprot webpage is shown below: those produced as a result of alternative splicing, proteolytic cleavage, post-translational modification. Examples of such information include its molecular weight and the presence of any known variants, e.g. Identifying the " canonical" protein sequence is another essential step permitting the collection of accurate information about the target protein. b) Using GENENAMES the alternative names/aliases of PIM2 are: Pim-2 proto-oncogene and serine/threonine kinase.a) Using GENECARDS website the alternative names/aliases of PIM2 are: pim-2 oncogene Pim-2h PIM2 proto-oncogene Pim-2 (serine threonine kinase) serine/threonine protein kinase pim-2 Serine/threonine-protein kinase pim-2.There are several different research engines for identifying the 'approved nomenclature', two of which are listed below. This unique identifier allows the clear and unambiguous referencing of genes in scientific communications, and facilitates any electronic data retrieval from databases and publications of the target protein to obtain correct information about the protein and any specific antibody or antibodies that may be available. The HUGO Gene Nomenclature Committee (HGNC) ensures that each gene is given only one approved gene symbol. It is essential to identify the ‘approved nomenclature’ For any protein comprises a short-form abbreviation known as its gene symbol and a longer more descriptive name. Example step 1 How to define a chosen antigen for a monoclonal antibody to PIM2 1 Identify the target antigen
0 kommentar(er)
